PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00339.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family S1Fa-like
Protein Properties Length: 126aa    MW: 14120.7 Da    PI: 10.8247
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00339.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA130.54.5e-41368368
                     S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavP 68
                             ++k e+kGlnPGlivllv+ggll++flvgn+ily+yaqknlP rkkkPvskkk+k+eklkqGv+vP
  Rsa1.0_00339.1_g00013.1  3 QGKLESKGLNPGLIVLLVIGGLLVTFLVGNFILYTYAQKNLPQRKKKPVSKKKMKKEKLKQGVQVP 68
                             6789*************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.1E-36668IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MRQGKLESKG LNPGLIVLLV IGGLLVTFLV GNFILYTYAQ KNLPQRKKKP VSKKKMKKEK  60
LKQGVQVPLH PSDGPSDLVI SFVMLWLSMK PRGLLGSSSE ETPRDVLRFE NQMNLNGPRE  120
ETQSGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884751.16e-21hypothetical protein ARALYDRAFT_478296, partial
RefseqXP_006298914.16e-21hypothetical protein CARUB_v10015035mg
RefseqXP_009146906.16e-21PREDICTED: DNA-binding protein S1FA3
RefseqXP_010104121.19e-21DNA-binding protein S1FA1
RefseqXP_013750388.16e-21PREDICTED: DNA-binding protein S1FA3
SwissprotQ423375e-17S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLA0A087H8A93e-22A0A087H8A9_ARAAL; Uncharacterized protein
STRINGBra034084.1-P4e-21(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769